PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462936127
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family B3
Protein Properties Length: 197aa    MW: 21492.1 Da    PI: 6.7834
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462936127genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B387.41.2e-27295194
               EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3  1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94
               f+kvltpsdv+k+++lv+pk++ae++  +   ++ l +ed+ g  W+++++y+++s++yv+tkGW++Fv+a +L +gD+v F++ g  ++++++
  462936127  2 FDKVLTPSDVGKLNWLVVPKQHAERFFPVAGAGTLLCFEDRAGAPWRFRYSYWGSSQSYVMTKGWSRFVRAARLAAGDTVSFSRAGAAGGRYFI 95
               89************************77888899*************************************************98887776666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.108.0E-351103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.15E-281100IPR015300DNA-binding pseudobarrel domain
CDDcd100172.49E-24190No hitNo description
PROSITE profilePS5086312.8582101IPR003340B3 DNA binding domain
PfamPF023621.0E-24295IPR003340B3 DNA binding domain
SMARTSM010197.0E-19298IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MFDKVLTPSD VGKLNWLVVP KQHAERFFPV AGAGTLLCFE DRAGAPWRFR YSYWGSSQSY  60
VMTKGWSRFV RAARLAAGDT VSFSRAGAAG GRYFIDYRHC QRRRREISFA DAAAVPAWPL  120
HHHDRLLQRT MMAGGEGASA AYAAVDVDDT VPVVAGHDAA EVGPSGAKCF RLFGVNVECT  180
SDEAAAAEQE ENVDGDT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wid_A1e-3619813115DNA-binding protein RAV1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0046981e-93AP004698.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0498E12.
GenBankAP0149641e-93AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126161e-93CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974419.17e-80PREDICTED: putative B3 domain-containing protein Os08g0157700
SwissprotQ7EZD52e-70Y8577_ORYSJ; Putative B3 domain-containing protein Os08g0157700
TrEMBLK3YJE38e-80K3YJE3_SETIT; Uncharacterized protein
STRINGSi014362m2e-79(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141642426
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61970.15e-44B3 family protein